DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG12926 and Sec14l4

DIOPT Version :9

Sequence 1:NP_610510.2 Gene:CG12926 / 35996 FlyBaseID:FBgn0033437 Length:313 Species:Drosophila melanogaster
Sequence 2:NP_666125.1 Gene:Sec14l4 / 103655 MGIID:2144095 Length:403 Species:Mus musculus


Alignment Length:267 Identity:59/267 - (22%)
Similarity:105/267 - (39%) Gaps:60/267 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 ELGEIPDRIDEDI----ETLRTWISKQPHLKARQDAQFLVAFLRGCKYSLEKTKLKLDNFYAMRG 83
            ::|::..:..|.:    |||:..:...|    :.|..||:.:||...:.|:|::..|......|.
Mouse     4 QVGDLSPQQQEALARFRETLQDLLPTLP----KADDYFLLRWLRARNFDLKKSEDMLRKHVEFRN 64

  Fly    84 ----------AVPELYKNRIVGEKQLSILDTGCLLRLPQPLQADGPRIHISRYGQYD-------- 130
                      ..||:          :.:.|:|.|    .....:|..:.....|..|        
Mouse    65 QQNLDQILTWQAPEV----------IQLYDSGGL----SGYDYEGCPVWFDIIGTMDPKGLFMSA 115

  Fly   131 SKKYSIAEVVQV-NTMLGEIQIREDD-NAMISGFVEIIDMKGVGAGHLF--------QFDAVLVK 185
            ||:..|.:.::| ..:|.|.:::... ...|...|.:.||:|:...||:        ||.|:|  
Mouse   116 SKQDMIRKRIKVCEMLLHECELQSQKLGRKIERMVMVFDMEGLSLRHLWKPAVEVYQQFFAIL-- 178

  Fly   186 KLAVLGDKAYPYRPKGFHFVNAPSSAEKFMSIAKSLMSEKIRKRFHI--HSKLDSLYKYVPKECL 248
                  :..||...|....:.||.......::.||.|.|:.:|:..|  .:....|.|:|..:.|
Mouse   179 ------EANYPETVKNLIIIRAPKLFPVAFNLVKSFMGEETQKKIVILGGNWKQELVKFVSPDQL 237

  Fly   249 PAEYGGS 255
            |.|:||:
Mouse   238 PVEFGGT 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG12926NP_610510.2 CRAL_TRIO_N 32..77 CDD:215024 13/48 (27%)
SEC14 117..254 CDD:238099 37/156 (24%)
Sec14l4NP_666125.1 CRAL_TRIO_N 13..59 CDD:215024 13/49 (27%)
SEC14 77..244 CDD:214706 43/188 (23%)
GOLD_2 284..379 CDD:290608
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.