DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstT1 and EEF1E1

DIOPT Version :9

Sequence 1:	NP_610509.2	Gene:	GstT1 / 35995	FlyBaseID:	FBgn0050000	Length:	228	Species:	Drosophila melanogaster
Sequence 2:	NP_004271.1	Gene:	EEF1E1 / 9521	HGNCID:	3212	Length:	174	Species:	Homo sapiens

Alignment Length:	115	Identity:	28/115 - (24%)
Similarity:	47/115 - (40%)	Gaps:	28/115 - (24%)

- Green bases have known domain annotations that are detailed below.

  Fly    84 EQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLG 148
            |.|...|.||:|.|.::||::...|....|                   ...:..|:||:.|.|.
Human    58 EYLLGSTAEEKAIVQQWLEYRVTQVDGHSS-------------------KNDIHTLLKDLNSYLE 103

  Fly   149 LLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQ-FPKVAKW 197
                   :|.:|.|...|:|||.....:::. :....|.||: :..|::|
Human   104 -------DKVYLTGYNFTLADILLYYGLHRF-IVDLTVQEKEKYLNVSRW 145

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstT1	NP_610509.2	GstA	5..204	CDD:223698	28/115 (24%)
		GST_N_Theta	5..80	CDD:239348
		GST_C_Theta	93..218	CDD:198292	24/106 (23%)
EEF1E1	NP_004271.1	N-terminal	2..56
		Linker	57..63		2/4 (50%)
		C-terminal	64..152		26/109 (24%)
		GST_C_AIMP3	65..165	CDD:198338	25/108 (23%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_COG0625
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	0.900