DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and sspA

DIOPT Version :10

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_417696.1 Gene:sspA / 944744 ECOCYCID:EG10977 Length:212 Species:Escherichia coli


Alignment Length:30 Identity:12/30 - (40%)
Similarity:18/30 - (60%) Gaps:0/30 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    50 INRFQKVPAIVDGKFQLGESVSIVRYLADK 79
            :|..|.||.:||.:..|.||..|:.||.::
E. coli    53 LNPNQSVPTLVDRELTLWESRIIMEYLDER 82

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GST_N_Theta 5..80 CDD:239348 12/30 (40%)
GST_C_Theta 93..218 CDD:198292
sspANP_417696.1 sspA 1..211 CDD:236537 12/30 (40%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.