DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GTT1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_012304.1 Gene:GTT1 / 854856 SGDID:S000001477 Length:234 Species:Saccharomyces cerevisiae


Alignment Length:250 Identity:50/250 - (20%)
Similarity:87/250 - (34%) Gaps:54/250 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAI-----VDGKF 64
            ||.::...|:..|.||:...| ...:|..|.......:...|.:.|:...:.|.:     ..||.
Yeast     6 IKVHWLDHSRAFRLLWLLDHL-NLEYEIVPYKRDANFRAPPELKKIHPLGRSPLLEVQDRETGKK 69

  Fly    65 Q-LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVR------------------- 109
            : |.||..|.:|:......|..|    :.|.|.:.:.:.:..|.|.                   
Yeast    70 KILAESGFIFQYVLQHFDHSHVL----MSEDADIADQINYYLFYVEGSLQPPLMIEFILSKVKDS 130

  Fly   110 ---LVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIF 171
               ...|...|:|    |..::.|.....||.....||..:.      ....:||..||:.|||.
Yeast   131 GMPFPISYLARKV----ADKISQAYSSGEVKNQFDFVEGEIS------KNNGYLVDGKLSGADIL 185

  Fly   172 GSSEINQMKLCQYNVNEKQFPKVAKWMERVRDATNPYYDEAHSFVYKTSQQAVKA 226
            .|..: ||...:.....:.:|.::||::.:....:          |..|::..:|
Yeast   186 MSFPL-QMAFERKFAAPEDYPAISKWLKTITSEES----------YAASKEKARA 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 47/226 (21%)
GST_N_Theta 5..80 CDD:239348 19/80 (24%)
GST_C_Theta 93..218 CDD:198292 26/146 (18%)
GTT1NP_012304.1 GST_N_GTT1_like 6..87 CDD:239344 19/81 (23%)
GST_C_GTT1_like 93..218 CDD:198298 26/135 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.