DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GTT2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_013040.1 Gene:GTT2 / 850666 SGDID:S000003983 Length:233 Species:Saccharomyces cerevisiae


Alignment Length:208 Identity:41/208 - (19%)
Similarity:70/208 - (33%) Gaps:74/208 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 VALRKQEQLTDEYRSINRFQKVPAI-VDGKFQLGESVSIVRYL--------------ADKGVFSE 84
            :.|.|.|....|:.:.|....||.: :|....:.|..:|..|:              .:|||.  
Yeast    51 INLWKGEHKKPEFLAKNYSGTVPVLELDDGTLIAECTAITEYIDALDGTPTLTGKTPLEKGVI-- 113

  Fly    85 QLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVE----S 145
                ..:.:||.: |.|:        ..|::|...    ..||.|            :||    .
Yeast   114 ----HMMNKRAEL-ELLD--------PVSVYFHHA----TPGLGP------------EVELYQNK 149

  Fly   146 NLGLLER------------LWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNE---------- 188
            ..||.:|            :..|:.::.||..::|||...:.:....:.:..|.|          
Yeast   150 EWGLRQRDKALHGMHYFDTVLRERPYVAGDSFSMADITVIAGLIFAAIVKLQVPEECEALRAWYK 214

  Fly   189 --KQFPKVAKWME 199
              :|.|.|.|.:|
Yeast   215 RMQQRPSVKKLLE 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 41/208 (20%)
GST_N_Theta 5..80 CDD:239348 11/59 (19%)
GST_C_Theta 93..218 CDD:198292 27/135 (20%)
GTT2NP_013040.1 GST_N_GTT2_like 19..94 CDD:239349 11/42 (26%)
GST_C_GTT2_like 106..222 CDD:198291 27/146 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157345126
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.740

Return to query results.
Submit another query.