DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTF14

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_175408.1 Gene:GSTF14 / 841409 AraportID:AT1G49860 Length:254 Species:Arabidopsis thaliana


Alignment Length:213 Identity:54/213 - (25%)
Similarity:97/213 - (45%) Gaps:28/213 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRS-INRFQKVPAIVDGKFQLGE 68
            :|.:..|:...|.||:...:.| ..||...|.....|..|..:.| :|.|.:||.:.||..:|.|
plant     6 MKLHCGFIWGNSAALFCINEKG-LDFELVFVDWLAGEAKTKTFLSTLNPFGEVPVLEDGDLKLFE 69

  Fly    69 SVSIVRYLAD--KGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP-- 129
            ..:|.||||:  |.| ...|.|...::||.:..::|........:.|...:::.:.|.:|||.  
plant    70 PKAITRYLAEQYKDV-GTNLLPDDPKKRAIMSMWMEVDSNQFLPIASTLIKELIINPYQGLATDD 133

  Fly   130 ---APKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQF 191
               ....|.:.:::...|:.||       |..:|.|:..::||:...:.|:.:    .|.:|::.
plant   134 TAVQENKEKLSEVLNIYETRLG-------ESPYLAGESFSLADLHHLAPIDYL----LNTDEEEL 187

  Fly   192 -------PKVAKWMERVR 202
                   |.||.|:|:::
plant   188 KNLIYSRPNVAAWVEKMK 205

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 54/213 (25%)
GST_N_Theta 5..80 CDD:239348 25/77 (32%)
GST_C_Theta 93..218 CDD:198292 25/122 (20%)
GSTF14NP_175408.1 GST_N_Phi 5..80 CDD:239351 25/74 (34%)
GST_C_Phi 94..214 CDD:198296 25/123 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.