DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and clic3

DIOPT Version :10

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_955818.1 Gene:clic3 / 84040 ZFINID:ZDB-GENE-010507-2 Length:239 Species:Danio rerio


Alignment Length:119 Identity:29/119 - (24%)
Similarity:42/119 - (35%) Gaps:36/119 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   127 LAPAPKPESVKKLIKDVES--NLGLLER----LWLEKDFLVGDKLTVADIFGSSEI-------NQ 178
            :|.|.|.|...|...|.||  |....:|    |||:.   |...||..|:..:.|:       :|
Zfish     1 MAEAAKIELFVKASDDGESVGNCPFCQRLFMILWLKG---VNFTLTTVDMKRAPEVLKDLAPGSQ 62

  Fly   179 MKLCQYN---------VNE--------KQFPKVAKWMERVRDATNPYYDEAHSF 215
            .....||         :.|        .|:||:..   |.:::.....|..|.|
Zfish    63 PPFLIYNGEVRTDTNKIEEFLEDTLAPPQYPKLCC---RYKESNTAGDDIFHKF 113

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GST_N_Theta 5..80 CDD:239348
GST_C_Theta 93..218 CDD:198292 29/119 (24%)
clic3NP_955818.1 O-ClC 6..237 CDD:129941 27/114 (24%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.