DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTF6

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001184893.1 Gene:GSTF6 / 839515 AraportID:AT1G02930 Length:208 Species:Arabidopsis thaliana


Alignment Length:217 Identity:59/217 - (27%)
Similarity:94/217 - (43%) Gaps:35/217 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69
            ||.:....|..:|.:.||:......||...|.|:..|...:.:...|.|.||||..||.|::.||
plant     4 IKVFGHPASTATRRVLIALHEKNVDFEFVHVELKDGEHKKEPFILRNPFGKVPAFEDGDFKIFES 68

  Fly    70 VSIVRYLA----DKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCS-LFFRQVWLLPAKGLAP 129
            .:|.:|:|    |||   ..|. .|.::.|.:...:|.:......|.| |.:.|| |.|..|:. 
plant    69 RAITQYIAHEFSDKG---NNLL-STGKDMAIIAMGIEIESHEFDPVGSKLVWEQV-LKPLYGMT- 127

  Fly   130 APKPESVKKLIKDVESNLG----LLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQY---NVN 187
                 :.|.::::.|:.|.    :.|....|..:|..|..|:.|      ::.:.:.||   ...
plant   128 -----TDKTVVEEEEAKLAKVLDVYEHRLGESKYLASDHFTLVD------LHTIPVIQYLLGTPT 181

  Fly   188 EKQF---PKVAKWMERVRDATN 206
            :|.|   |.|:.|   |.|.|:
plant   182 KKLFDERPHVSAW---VADITS 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 57/213 (27%)
GST_N_Theta 5..80 CDD:239348 26/78 (33%)
GST_C_Theta 93..218 CDD:198292 29/125 (23%)
GSTF6NP_001184893.1 GST_N_Phi 4..77 CDD:239351 24/72 (33%)
GST_C_Phi 91..208 CDD:198296 29/126 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.