DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTF4

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001320441.1 Gene:GSTF4 / 838240 AraportID:AT1G02950 Length:255 Species:Arabidopsis thaliana


Alignment Length:231 Identity:57/231 - (24%)
Similarity:104/231 - (45%) Gaps:34/231 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 KYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESV 70
            |.:.|..|..:|.:...:...:..:|...|.|:..|..|:.:.|:|.|.:||...||..:|.||.
plant    38 KVHGDPFSTNTRRVLAVLHEKRLSYEPITVKLQTGEHKTEPFLSLNPFGQVPVFEDGSVKLYESR 102

  Fly    71 SIVRYLA----DKGVFSEQLYPKTLEERARVDEFLEWQ-HFNVRLVCSLFFRQVWLLPAKGLAPA 130
            :|.:|:|    .:|  ::.|..::.|..|.:..::|.: |........|.:.|| :.|..||   
plant   103 AITQYIAYVHSSRG--TQLLNLRSHETMATLTMWMEIEAHQFDPPASKLTWEQV-IKPIYGL--- 161

  Fly   131 PKPESVKKLIKD----VESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQY------- 184
               |:.:.::|:    :|..|.:.|:...|..||..:..|:.|      ::.:...||       
plant   162 ---ETDQTIVKENEAILEKVLNIYEKRLEESRFLACNSFTLVD------LHHLPNIQYLLGTPTK 217

  Fly   185 NVNEKQFPKVAKWMERV--RDATNPYYDEAHSFVYK 218
            .:.||: .||.||::.:  |:|.....|:..|:..|
plant   218 KLFEKR-SKVRKWVDEITSREAWKMACDQEKSWFNK 252

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 53/215 (25%)
GST_N_Theta 5..80 CDD:239348 22/77 (29%)
GST_C_Theta 93..218 CDD:198292 31/138 (22%)
GSTF4NP_001320441.1 GST_N_Phi 38..109 CDD:239351 21/70 (30%)
GST_C_Phi 126..243 CDD:198296 30/130 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.