DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and Clic4

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_114006.1 Gene:Clic4 / 83718 RGDID:61857 Length:253 Species:Rattus norvegicus


Alignment Length:156 Identity:34/156 - (21%)
Similarity:56/156 - (35%) Gaps:63/156 - (40%)


- Green bases have known domain annotations that are detailed below.


  Fly    96 RVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPK-PES------------------------ 135
            :::||||      .::|          |.|.|..:|| |||                        
  Rat    90 KIEEFLE------EVLC----------PPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANE 138

  Fly   136 ---------VKKLIKDVESNL-GLLERLWLE------KDFLVGDKLTVADIFGSSEINQMKLCQY 184
                     ::||.:.:.|.| |.::...:|      :.||.||::|:||.....:::.:|:...
  Rat   139 ALERGLLKTLQKLDEYLNSPLPGEIDENSMEDIKSSTRRFLDGDEMTLADCNLLPKLHIVKVVAK 203

  Fly   185 NVNEKQFPK--VAKWMERVRDATNPY 208
            .......||  ...|    |..||.|
  Rat   204 KYRNFDIPKGMTGIW----RYLTNAY 225

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 31/150 (21%)
GST_N_Theta 5..80 CDD:239348
GST_C_Theta 93..218 CDD:198292 34/156 (22%)
Clic4NP_114006.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..101 5/26 (19%)
GST_N_CLIC 14..104 CDD:239359 6/29 (21%)
O-ClC 17..252 CDD:129941 34/156 (22%)
GST_C_family 111..251 CDD:295467 24/119 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166347838
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.