DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTT3

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_198938.1 Gene:GSTT3 / 834124 AraportID:AT5G41220 Length:590 Species:Arabidopsis thaliana


Alignment Length:236 Identity:77/236 - (32%)
Similarity:129/236 - (54%) Gaps:21/236 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69
            :|.|.|.:||||||:.|..|:.:..|::..:.|..::||:.|::.||...|||||||||.:|.||
plant     3 LKVYADRMSQPSRAVLIFCKVNEIQFDEILIYLANRQQLSPEFKDINPMGKVPAIVDGKLKLSES 67

  Fly    70 VSIVRYLADK-GVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPK- 132
            .:|:.||:.. ....:..||..|.:|||:...|:|.|.|:|...:.:.....|.||.||...|| 
plant    68 HAILIYLSSAYPSVVDHWYPTDLSKRARIHSVLDWHHTNLRPGAAGYVLNSVLGPALGLPLNPKA 132

  Fly   133 -PESVKKLIKDVESNLGLLERLWLEKD--FLVG-DKLTVADIFGSSEINQMKLCQYNVNEKQ--- 190
             .|:.:.|.|    :|..|:..||:.:  ||:| ::.::||:....|:.|:::    :::|.   
plant   133 AAEAEQLLTK----SLTTLDTFWLKGNAMFLLGSNQPSIADLSLVCELTQLQV----LDDKDRLR 189

  Fly   191 ----FPKVAKWMERVRDATNPYYDEAHSFVYKTSQQAVKAK 227
                ...|.:|:|..|.||.|::||.|..:::...:..|.:
plant   190 LLSPHKNVEQWIENTRKATMPHFDEVHEVLFRAKDRCQKQR 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 70/211 (33%)
GST_N_Theta 5..80 CDD:239348 33/75 (44%)
GST_C_Theta 93..218 CDD:198292 40/136 (29%)
GSTT3NP_198938.1 PLN02473 1..202 CDD:166114 68/206 (33%)
GST_N_Theta 3..78 CDD:239348 33/74 (45%)
GST_C_Theta 92..221 CDD:198292 40/136 (29%)
NAM-associated 378..>455 CDD:291001
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 64 1.000 Domainoid score I3657
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm1047
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
109.680

Return to query results.
Submit another query.