DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and ATGSTF13

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_191835.1 Gene:ATGSTF13 / 825451 AraportID:AT3G62760 Length:219 Species:Arabidopsis thaliana


Alignment Length:216 Identity:61/216 - (28%)
Similarity:93/216 - (43%) Gaps:40/216 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 AIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGE 68
            |:|.|.|.:|.....:.:.:....|.||..||.|.........:.|:|.|.||||:.|....|.|
plant     2 AMKLYGDEMSACVARVLLCLHEKNTEFELVPVNLFACHHKLPSFLSMNPFGKVPALQDDDLTLFE 66

  Fly    69 SVSIVRYLA----DKGV-FSEQLYPKTLEERARVDEF--LEWQHFNVRLVCSLFFRQVWLLPAKG 126
            |.:|..|:|    |||. .:....||   |.|.|..:  :|..|||..:  |....|:.::|.:|
plant    67 SRAITAYIAEKHRDKGTDLTRHEDPK---EAAIVKLWSEVEAHHFNPAI--SAVIHQLIVVPLQG 126

  Fly   127 LAPAPKPESVKKLIKDVESNLGLL-----ERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQY-- 184
            .:|.      ..::::...|||.:     |||...| :|.||..|:||      ::.:....|  
plant   127 ESPN------AAIVEENLENLGKILDVYEERLGKTK-YLAGDTYTLAD------LHHVPYTYYFM 178

  Fly   185 ------NVNEKQFPKVAKWME 199
                  .:|::  |.|..|.|
plant   179 KTIHAGLINDR--PNVKAWWE 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 60/215 (28%)
GST_N_Theta 5..80 CDD:239348 25/78 (32%)
GST_C_Theta 93..218 CDD:198292 31/122 (25%)
ATGSTF13NP_191835.1 PLN02395 1..209 CDD:166036 61/216 (28%)
GST_N_Phi 2..77 CDD:239351 25/74 (34%)
GST_C_Phi 92..208 CDD:198296 32/126 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.