DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTF10

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_180644.1 Gene:GSTF10 / 817637 AraportID:AT2G30870 Length:215 Species:Arabidopsis thaliana


Alignment Length:213 Identity:56/213 - (26%)
Similarity:100/213 - (46%) Gaps:39/213 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSI 72
            |....:...||:...::.| ..||...|.|.|.||...||.:|..|.|:|.:|||.:::.||.:|
plant     6 YAPLFASSKRAVVTLVEKG-VSFETVNVDLMKGEQRQPEYLAIQPFGKIPVLVDGDYKIFESRAI 69

  Fly    73 VRYLADKGVFSEQ---LYPKTLEERARVDEFLEWQHFN-----VRLVCSLFFRQVWLLPAKGLAP 129
            :||:|:|  :..|   |..||:|||.:|:::|:.:..:     :.|..::.|..:...||.    
plant    70 MRYIAEK--YRSQGPDLLGKTIEERGQVEQWLDVEATSYHPPLLALTLNIVFAPLMGFPAD---- 128

  Fly   130 APKPESVKKLIKDVESNLG----LLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNE-- 188
                   :|:||:.|..|.    :.|....:.::|.||.:::||      :..:...:|.|..  
plant   129 -------EKVIKESEEKLAEVLDVYEAQLSKNEYLAGDFVSLAD------LAHLPFTEYLVGPIG 180

  Fly   189 -----KQFPKVAKWMERV 201
                 |....|:.|.:::
plant   181 KAHLIKDRKHVSAWWDKI 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/213 (26%)
GST_N_Theta 5..80 CDD:239348 26/71 (37%)
GST_C_Theta 93..218 CDD:198292 24/125 (19%)
GSTF10NP_180644.1 PLN02395 1..215 CDD:166036 56/213 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.820

Return to query results.
Submit another query.