DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTF9

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_180643.1 Gene:GSTF9 / 817636 AraportID:AT2G30860 Length:215 Species:Arabidopsis thaliana


Alignment Length:178 Identity:56/178 - (31%)
Similarity:91/178 - (51%) Gaps:26/178 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69
            :|.|....:.|.|||...::.| ..||..||.|.|.|.....|.::..|..|||:|||.:::.||
plant     3 LKVYGPHFASPKRALVTLIEKG-VAFETIPVDLMKGEHKQPAYLALQPFGTVPAVVDGDYKIFES 66

  Fly    70 VSIVRYLADKGVFSEQ---LYPKTLEERARVDEFLEWQHFN-----VRLVCSLFFRQVWLLPAKG 126
            .:::||:|:|  :..|   |..||:|:|.:|:::|:.:...     :.|...:.|..|...|   
plant    67 RAVMRYVAEK--YRSQGPDLLGKTVEDRGQVEQWLDVEATTYHPPLLNLTLHIMFASVMGFP--- 126

  Fly   127 LAPAPKPESVKKLIKDVESNL-GLLE--RLWLEKD-FLVGDKLTVADI 170
                    |.:||||:.|..| |:|:  ...|.|. :|.||.:::||:
plant   127 --------SDEKLIKESEEKLAGVLDVYEAHLSKSKYLAGDFVSLADL 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/178 (31%)
GST_N_Theta 5..80 CDD:239348 27/74 (36%)
GST_C_Theta 93..218 CDD:198292 23/87 (26%)
GSTF9NP_180643.1 PLN02395 1..215 CDD:166036 56/178 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
65.820

Return to query results.
Submit another query.