DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTF3

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_178394.1 Gene:GSTF3 / 814822 AraportID:AT2G02930 Length:212 Species:Arabidopsis thaliana


Alignment Length:214 Identity:52/214 - (24%)
Similarity:91/214 - (42%) Gaps:32/214 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69
            ||.:....|..:|.:.||:......||...|.|:..|...:.:.|.|.|.:|||..||..:|.||
plant     4 IKVFGHPASTSTRRVLIALHEKNLDFELVHVELKDGEHKKEPFLSRNPFGQVPAFEDGDLKLFES 68

  Fly    70 VSIVRYLADKGVFSEQ---LYP---KTLEERARVDEFLEWQHFNVRLVCS-LFFRQVWL----LP 123
            .:|.:|:|.:  :..|   |.|   |.:.:.|.:...::.:......|.| |.:.||:.    |.
plant    69 RAITQYIAHR--YENQGTNLLPADSKNIAQYAIMSIGIQVEAHQFDPVASKLAWEQVFKFNYGLN 131

  Fly   124 AKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQY---N 185
            ......|.:...:.|::...|:.|       .|..:|.|:..|:.|      ::.:.:.||   .
plant   132 TDQAVVAEEEAKLAKVLDVYEARL-------KEFKYLAGETFTLTD------LHHIPVIQYLLGT 183

  Fly   186 VNEKQF---PKVAKWMERV 201
            ..:|.|   |:|.:|:..:
plant   184 PTKKLFTERPRVNEWVAEI 202

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 52/214 (24%)
GST_N_Theta 5..80 CDD:239348 25/74 (34%)
GST_C_Theta 93..218 CDD:198292 23/120 (19%)
GSTF3NP_178394.1 PLN02473 4..212 CDD:166114 52/214 (24%)
GST_N_Phi 4..78 CDD:239351 25/73 (34%)
GST_C_Phi 96..212 CDD:198296 23/120 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.720

Return to query results.
Submit another query.