DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gdap1l1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_687373.1 Gene:gdap1l1 / 562163 ZFINID:ZDB-GENE-080812-2 Length:367 Species:Danio rerio


Alignment Length:273 Identity:51/273 - (18%)
Similarity:94/273 - (34%) Gaps:85/273 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRY-------------LADKG-- 80
            |:..|:|...||....:..:|..::||..:.|...:.:...|:.|             :.|:|  
Zfish    74 EERDVSLPLTEQKEPWFMRLNLGEEVPVFIHGDTIVSDYNQIIDYIETNFVGDTVAQLIPDEGTP 138

  Fly    81 -----------------------------VFSEQLYPK--TLEERARV----DEFLEWQHFNVRL 110
                                         :.::.:.||  |.|.|..:    .|.::..|...:|
Zfish   139 MYARVQQYRELLDGLPMDAYTHGCILHPELTTDSMIPKYATAEIRRHLANAASELMKLDHEEPQL 203

  Fly   111 VCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLLE---------------RLWLEKDFL 160
            ......:|..|: || :........:||::.::...|..:|               .||     |
Zfish   204 TEPYLSKQKKLM-AK-ILDHDNVNYLKKILGELAMVLDQVEAELEKRKLEYQGQKCELW-----L 261

  Fly   161 VGDKLTVADIFGSSEINQMKLCQYNVNEKQF-----PKVAKWMERV--RDATNPYYDEAH----S 214
            .|...|:|||...:.::::|.  ..::.|.:     |.:..:.|||  |.|......:.|    |
Zfish   262 CGPTFTLADICLGATLHRLKF--LGLSRKYWEDGSRPNLQSFFERVQKRYAFRKVLGDIHTTLLS 324

  Fly   215 FVYKTSQQAVKAK 227
            .|...:.:.||.|
Zfish   325 AVLPNAFRMVKKK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 44/244 (18%)
GST_N_Theta 5..80 CDD:239348 12/61 (20%)
GST_C_Theta 93..218 CDD:198292 31/154 (20%)
gdap1l1XP_687373.1 GstA 48..314 CDD:223698 45/248 (18%)
Thioredoxin_like 48..120 CDD:294274 11/45 (24%)
GST_C_GDAP1L1 201..311 CDD:198335 24/118 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589582
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.