Sequence 1: | NP_610509.2 | Gene: | GstT1 / 35995 | FlyBaseID: | FBgn0050000 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_016883895.1 | Gene: | CLIC6 / 54102 | HGNCID: | 2065 | Length: | 735 | Species: | Homo sapiens |
Alignment Length: | 198 | Identity: | 36/198 - (18%) |
---|---|---|---|
Similarity: | 63/198 - (31%) | Gaps: | 62/198 - (31%) |
- Green bases have known domain annotations that are detailed below.
Fly 38 RKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLE 102
Fly 103 WQH---FNVRLVCSLFFRQVWLLPA--KGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVG 162
Fly 163 DKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMERVRDATNPYYDEAHSFVYKTSQQA--VK 225
Fly 226 AKN 228 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT1 | NP_610509.2 | GstA | 5..204 | CDD:223698 | 29/170 (17%) |
GST_N_Theta | 5..80 | CDD:239348 | 7/41 (17%) | ||
GST_C_Theta | 93..218 | CDD:198292 | 22/129 (17%) | ||
CLIC6 | XP_016883895.1 | None |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165154372 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |