DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and CLIC6

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_016883895.1 Gene:CLIC6 / 54102 HGNCID:2065 Length:735 Species:Homo sapiens


Alignment Length:198 Identity:36/198 - (18%)
Similarity:63/198 - (31%) Gaps:62/198 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 RKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLE 102
            |:::....|.|::.:...:...|...:. |||:.       ...||::|:            .:.
Human   435 RREDGEASEPRALGQEHDITLFVKAGYD-GESIG-------NCPFSQRLF------------MIL 479

  Fly   103 WQH---FNVRLVCSLFFRQVWLLPA--KGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVG 162
            |..   |||..|      .:...||  :.|||...|                        .|:..
Human   480 WLKGVIFNVTTV------DLKRKPADLQNLAPGTNP------------------------PFMTF 514

  Fly   163 DKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMERVRDATNPYYDEAHSFVYKTSQQA--VK 225
            |.....|:....|..:.||.     ..::||:.........|.|..:.:..:|:..|.:.|  :.
Human   515 DGEVKTDVNKIEEFLEEKLA-----PPRYPKLGTQHPESNSAGNDVFAKFSAFIKNTKKDANEIH 574

  Fly   226 AKN 228
            .||
Human   575 EKN 577

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 29/170 (17%)
GST_N_Theta 5..80 CDD:239348 7/41 (17%)
GST_C_Theta 93..218 CDD:198292 22/129 (17%)
CLIC6XP_016883895.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154372
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.