powered by:
Protein Alignment GstT1 and clic5a
DIOPT Version :9
Sequence 1: | NP_610509.2 |
Gene: | GstT1 / 35995 |
FlyBaseID: | FBgn0050000 |
Length: | 228 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001007386.1 |
Gene: | clic5a / 492513 |
ZFINID: | ZDB-GENE-041114-84 |
Length: | 246 |
Species: | Danio rerio |
Alignment Length: | 56 |
Identity: | 15/56 - (26%) |
Similarity: | 28/56 - (50%) |
Gaps: | 18/56 - (32%) |
- Green bases have known domain annotations that are detailed below.
Fly 132 KPES-------VKKLIKDVES--NLGLLERLWLE---------KDFLVGDKLTVAD 169
|||: :.|::|.::| |..|.:.:..| :.:|.|::||:||
Zfish 126 KPEANASLEKGLLKVLKKLDSFLNSPLPDEIDAESTGEEKSSNRKYLDGNELTLAD 181
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
1 |
0.930 |
- |
- |
|
C170589590 |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.930 |
|
Return to query results.
Submit another query.