DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gsto2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001007373.1 Gene:gsto2 / 492500 ZFINID:ZDB-GENE-041114-67 Length:240 Species:Danio rerio


Alignment Length:200 Identity:50/200 - (25%)
Similarity:72/200 - (36%) Gaps:59/200 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CPVALRKQEQLT-----------------DEYRSINRFQKVPAIVDGKFQ-LGESVSIVRYLADK 79
            ||.|.|.:..||                 |.:...|.|..||.:.....| :.||.....||.: 
Zfish    31 CPFAQRTRLVLTAKGVKHDIININLVSKPDWFLKKNPFGTVPVLETSSGQVIYESPITCEYLDE- 94

  Fly    80 GVFSE-QLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDV 143
             |:.| :|.|....|||:....||                   |.:|.:....|....||..:||
Zfish    95 -VYPEKKLLPSDPFERAQQKMLLE-------------------LYSKVIPYFYKISMGKKRGEDV 139

  Fly   144 --------ESNLGLLERLWLEK-DFLVGDKLTVADI-----FGSSEINQMKLCQYNVNEKQFPKV 194
                    |..|.|.|.|..:| .:..||.:|:.|.     |..:|:..:|.|.     .:.|::
Zfish   140 STAEAEFTEKLLQLNEALANKKTKYFGGDSITMIDYLIWPWFERAEMMGVKHCL-----AKTPEL 199

  Fly   195 AKWME 199
            .||:|
Zfish   200 RKWIE 204

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 49/199 (25%)
GST_N_Theta 5..80 CDD:239348 16/64 (25%)
GST_C_Theta 93..218 CDD:198292 29/120 (24%)
gsto2NP_001007373.1 GST_N_Omega 4..93 CDD:239353 15/61 (25%)
GstA 25..210 CDD:223698 49/199 (25%)
GST_C_Omega 107..229 CDD:198293 29/121 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589457
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.