Sequence 1: | NP_610509.2 | Gene: | GstT1 / 35995 | FlyBaseID: | FBgn0050000 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001007373.1 | Gene: | gsto2 / 492500 | ZFINID: | ZDB-GENE-041114-67 | Length: | 240 | Species: | Danio rerio |
Alignment Length: | 200 | Identity: | 50/200 - (25%) |
---|---|---|---|
Similarity: | 72/200 - (36%) | Gaps: | 59/200 - (29%) |
- Green bases have known domain annotations that are detailed below.
Fly 33 CPVALRKQEQLT-----------------DEYRSINRFQKVPAIVDGKFQ-LGESVSIVRYLADK 79
Fly 80 GVFSE-QLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDV 143
Fly 144 --------ESNLGLLERLWLEK-DFLVGDKLTVADI-----FGSSEINQMKLCQYNVNEKQFPKV 194
Fly 195 AKWME 199 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT1 | NP_610509.2 | GstA | 5..204 | CDD:223698 | 49/199 (25%) |
GST_N_Theta | 5..80 | CDD:239348 | 16/64 (25%) | ||
GST_C_Theta | 93..218 | CDD:198292 | 29/120 (24%) | ||
gsto2 | NP_001007373.1 | GST_N_Omega | 4..93 | CDD:239353 | 15/61 (25%) |
GstA | 25..210 | CDD:223698 | 49/199 (25%) | ||
GST_C_Omega | 107..229 | CDD:198293 | 29/121 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589457 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.840 |