DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstD8

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524916.1 Gene:GstD8 / 48341 FlyBaseID:FBgn0010044 Length:212 Species:Drosophila melanogaster


Alignment Length:210 Identity:60/210 - (28%)
Similarity:111/210 - (52%) Gaps:22/210 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YYYDFLSQPSRALWIAMK-LGKTPFEDCPVALRK---QEQLTDEYRSINRFQKVPAIVDGKFQLG 67
            :||...|.|.|::.:..| ||    .|..:.|.|   .|||..|:..:|....:|.:||..|.:.
  Fly     3 FYYHPCSAPCRSVIMTAKALG----VDLNMKLLKVMDGEQLKPEFVKLNPQHCIPTLVDDGFSIW 63

  Fly    68 ESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLP-AKGLAPAP 131
            ||.:|:.||.:|....:.|||...:::|.|::.|   :|::..:...|...::  | .:...|| 
  Fly    64 ESRAILIYLVEKYGADDSLYPSDPQKKAVVNQRL---YFDMGTLFQSFVEAIY--PQIRNNHPA- 122

  Fly   132 KPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAK 196
            .||:::|    |:|..|.|:....:::::.||.||:|||...:.::..::..:::  .|:|.||:
  Fly   123 DPEAMQK----VDSAFGHLDTFLEDQEYVAGDCLTIADIALLASVSTFEVVDFDI--AQYPNVAR 181

  Fly   197 WMERVRDATNPYYDE 211
            |.|..::.| |.::|
  Fly   182 WYENAKEVT-PGWEE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 57/201 (28%)
GST_N_Theta 5..80 CDD:239348 25/76 (33%)
GST_C_Theta 93..218 CDD:198292 31/120 (26%)
GstD8NP_524916.1 GstA 1..188 CDD:223698 57/200 (29%)
GST_N_Delta_Epsilon 1..74 CDD:239343 25/74 (34%)
GST_C_Delta_Epsilon 88..204 CDD:198287 31/121 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460064
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.