DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstD6

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_524915.1 Gene:GstD6 / 48339 FlyBaseID:FBgn0010042 Length:215 Species:Drosophila melanogaster


Alignment Length:208 Identity:54/208 - (25%)
Similarity:99/208 - (47%) Gaps:21/208 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 YDFLSQPS-RALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSI 72
            |:....|| ||:.:..|.....|....|.....|||...:..||....:|.:||..|.:.|:.:|
  Fly     4 YNMSGSPSTRAVMMTAKAVGVEFNSIQVNTFVGEQLEPWFVKINPQHTIPTLVDNLFVIWETRAI 68

  Fly    73 VRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRL----VCSLFFRQVWLLPAKGLAPAPKP 133
            |.||.::....:.||||..:::|.:::.|   :|::..    :...||         .|....||
  Fly    69 VVYLVEQYGKDDSLYPKDPQKQALINQRL---YFDMGTLYDGIAKYFF---------PLLRTGKP 121

  Fly   134 ESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWM 198
            .:.:.|.| :.:...||......:|::.|::|:||||...:.::..::..:::  |:||.|.:|.
  Fly   122 GTQENLEK-LNAAFDLLNNFLDGQDYVAGNQLSVADIVILATVSTTEMVDFDL--KKFPNVDRWY 183

  Fly   199 ERVRDATNPYYDE 211
            :..:..| |.:||
  Fly   184 KNAQKVT-PGWDE 195

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 50/199 (25%)
GST_N_Theta 5..80 CDD:239348 22/71 (31%)
GST_C_Theta 93..218 CDD:198292 28/123 (23%)
GstD6NP_524915.1 GST_N_Delta_Epsilon 1..74 CDD:239343 22/69 (32%)
PLN02395 11..208 CDD:166036 52/201 (26%)
GST_C_Delta_Epsilon 88..204 CDD:198287 28/124 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460068
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.