DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstD3

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_788656.1 Gene:GstD3 / 48336 FlyBaseID:FBgn0010039 Length:199 Species:Drosophila melanogaster


Alignment Length:176 Identity:45/176 - (25%)
Similarity:91/176 - (51%) Gaps:18/176 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 KQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEW 103
            |.||:..::..||....:|.:||..|.:.||.:|:.||.:|....:.||||.::::|.:::.|  
  Fly    19 KGEQMNPDFIKINPQHSIPTLVDNGFTIWESRAILVYLVEKYGKDDALYPKDIQKQAVINQRL-- 81

  Fly   104 QHFNVRLV---CSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKL 165
             :|::.|:   .:.::.:.:.....|     ..|..||    |:.....|......:|::.||:.
  Fly    82 -YFDMALMYPTLANYYYKAFTTGQFG-----SEEDYKK----VQETFDFLNTFLEGQDYVAGDQY 136

  Fly   166 TVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMERVRDATNPYYDE 211
            |||||...:.::...:..::::  ::|.||:|.:.|:..| |.::|
  Fly   137 TVADIAILANVSNFDVVGFDIS--KYPNVARWYDHVKKIT-PGWEE 179

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 42/167 (25%)
GST_N_Theta 5..80 CDD:239348 14/40 (35%)
GST_C_Theta 93..218 CDD:198292 26/122 (21%)
GstD3NP_788656.1 GST_N_Delta_Epsilon <1..58 CDD:239343 14/38 (37%)
GstA 6..173 CDD:223698 42/167 (25%)
GST_C_Delta_Epsilon 72..188 CDD:198287 26/123 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460070
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D518126at33208
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.