DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gstt1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001006811.1 Gene:gstt1 / 448525 XenbaseID:XB-GENE-998695 Length:242 Species:Xenopus tropicalis


Alignment Length:224 Identity:78/224 - (34%)
Similarity:119/224 - (53%) Gaps:16/224 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSI 72
            |.|.||||.|:::|..|....||.:..|.|.|.|.||:||..:|..:||||:.|..|.:.||.::
 Frog     7 YLDLLSQPCRSVYIFAKANNIPFNNHQVRLFKGEHLTEEYGKVNVLRKVPALKDCDFFMAESTAM 71

  Fly    73 VRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP------AP 131
            :.|:|.|...::..||..:::.|:|||:|.|||.|.|...|..|   |:   |.|.|      ||
 Frog    72 LLYMARKFKTADHWYPSDIQKCAKVDEYLAWQHTNTRPNGSKVF---WV---KCLTPLILGQEAP 130

  Fly   132 KPESVKKLIKDVESNLGLLERLWL-EKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVA 195
             .|.|..::.:..:.:...|..:| .|.|:.||:::|||:....||.|:.....||.:.: ||:|
 Frog   131 -AEKVDAVVAEFNTTMNNFEEKFLGNKLFIAGDEISVADLVAIVEIMQVVAGGINVFDDR-PKLA 193

  Fly   196 KWMERVRDAT-NPYYDEAHSFVYKTSQQA 223
            .|.:||.:|. ...:.|||..:....:.|
 Frog   194 AWKKRVVEALGEELFLEAHEGILNAKKMA 222

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 73/202 (36%)
GST_N_Theta 5..80 CDD:239348 30/71 (42%)
GST_C_Theta 93..218 CDD:198292 44/132 (33%)
gstt1NP_001006811.1 GST_N_Theta 4..79 CDD:239348 30/71 (42%)
GST_C_Theta 92..217 CDD:198292 44/132 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 64 1.000 Domainoid score I9934
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 1 1.000 - - mtm9437
Panther 1 1.100 - - O PTHR43917
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
66.110

Return to query results.
Submit another query.