DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and eEF1gamma

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001189308.1 Gene:eEF1gamma / 44791 FlyBaseID:FBgn0029176 Length:431 Species:Drosophila melanogaster


Alignment Length:201 Identity:50/201 - (24%)
Similarity:87/201 - (43%) Gaps:45/201 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    55 KVPAI--VDGKFQLGESVSIVRYLADKGVFSEQLY-PKTLEERARVDEFLEW-QHFNVRLVCSLF 115
            ||||.  .:|:: |.||.:|...||     :|||. .|....:|:|.:::.: .:..|...|:  
  Fly    54 KVPAFETAEGQY-LSESNAIAYLLA-----NEQLRGGKCPFVQAQVQQWISFADNEIVPASCA-- 110

  Fly   116 FRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMK 180
                |:.|..|:.|..|..:.|   ::.|:.|..|.:...:..||.|:::|:|||...|.:  :.
  Fly   111 ----WVFPLLGILPQQKNSTAK---QEAEAVLQQLNQKLQDATFLAGERITLADIVVFSSL--LH 166

  Fly   181 LCQYNVN---EKQFPKVAKW------MERVRDATNPY--------YD-------EAHSFVYKTSQ 221
            |.:|.:.   ...|..|.:|      .::|:.....|        :|       :|.:...|..|
  Fly   167 LYEYVLEPSVRSAFGNVNRWFVTILNQKQVQAVVKDYKLCEKALVFDPKKYAEFQAKTGAAKPQQ 231

  Fly   222 QAVKAK 227
            ||.:.|
  Fly   232 QAQQQK 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 42/161 (26%)
GST_N_Theta 5..80 CDD:239348 11/26 (42%)
GST_C_Theta 93..218 CDD:198292 30/149 (20%)
eEF1gammaNP_001189308.1 GST_N_EF1Bgamma 4..79 CDD:239342 11/30 (37%)
GstA 5..187 CDD:223698 40/149 (27%)
GST_C_EF1Bgamma_like 90..209 CDD:198290 28/129 (22%)
EF1G 271..376 CDD:279041
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45459931
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.