DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and clic2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001002561.2 Gene:clic2 / 436834 ZFINID:ZDB-GENE-040718-299 Length:239 Species:Danio rerio


Alignment Length:144 Identity:29/144 - (20%)
Similarity:62/144 - (43%) Gaps:36/144 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYPKTLE-ERARVDEFLE-------WQHFNVRL---------VCSLFFRQVWLLPAKGLAPAPKP 133
            ||..||: :..:::||||       :.|.:.|.         :.:.|...:...|..........
Zfish    73 LYNGTLKTDFIKIEEFLETTLAPPRYPHLSPRYKESFDVGADIFAKFSAFIKNSPNNAFHEKALL 137

  Fly   134 ESVKKL-------IKD-VESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKL-----CQYN 185
            ...|:|       ::| ::.|:.:.:|     .||.|::||:||.....:::.:|:     |.::
Zfish   138 REFKRLDDYLNTPLQDELDQNISVSKR-----KFLDGNRLTLADCNLLPKLHVIKVAARKYCNFD 197

  Fly   186 VNEKQFPKVAKWME 199
            : ..||..|.::::
Zfish   198 I-PTQFTGVWRYLQ 210

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 29/144 (20%)
GST_N_Theta 5..80 CDD:239348
GST_C_Theta 93..218 CDD:198292 25/136 (18%)
clic2NP_001002561.2 O-ClC 11..238 CDD:129941 29/144 (20%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589552
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.