DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstD1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001034042.1 Gene:GstD1 / 41503 FlyBaseID:FBgn0001149 Length:209 Species:Drosophila melanogaster


Alignment Length:211 Identity:59/211 - (27%)
Similarity:106/211 - (50%) Gaps:20/211 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69
            :.:||...|.|.|::.:..|..........:.|:..|.|..|:..||....:|.:||..|.|.||
  Fly     2 VDFYYLPGSSPCRSVIMTAKAVGVELNKKLLNLQAGEHLKPEFLKINPQHTIPTLVDNGFALWES 66

  Fly    70 VSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNV----RLVCSLFFRQVWLLPAKGLAPA 130
            .:|..||.:|...::.||||..::||.:::.|   :|::    :...:.::.||:   ||  |||
  Fly    67 RAIQVYLVEKYGKTDSLYPKCPKKRAVINQRL---YFDMGTLYQSFANYYYPQVF---AK--APA 123

  Fly   131 PKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVA 195
             .||:.||    :|:....|......:|:..||.||||||...:.::..::.::.::  ::..|.
  Fly   124 -DPEAFKK----IEAAFEFLNTFLEGQDYAAGDSLTVADIALVATVSTFEVAKFEIS--KYANVN 181

  Fly   196 KWMERVRDATNPYYDE 211
            :|.|..:..| |.::|
  Fly   182 RWYENAKKVT-PGWEE 196

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 56/202 (28%)
GST_N_Theta 5..80 CDD:239348 22/74 (30%)
GST_C_Theta 93..218 CDD:198292 32/123 (26%)
GstD1NP_001034042.1 GST_N_Delta_Epsilon 2..75 CDD:239343 22/72 (31%)
GstA 4..185 CDD:223698 55/195 (28%)
GST_C_Delta_Epsilon 89..205 CDD:198287 32/124 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460062
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.