DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstD9

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001287303.1 Gene:GstD9 / 41502 FlyBaseID:FBgn0038020 Length:218 Species:Drosophila melanogaster


Alignment Length:207 Identity:48/207 - (23%)
Similarity:94/207 - (45%) Gaps:10/207 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     5 IKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGES 69
            :.:||...|.|.|::.:..:..........|.|...|.|..|:..||....:|.:||..|.:.||
  Fly     2 LDFYYMLYSAPCRSILMTARALGLELNKKQVDLDAGEHLKPEFVKINPQHTIPTLVDDGFAIWES 66

  Fly    70 VSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPE 134
            .:|:.|||:|......||||..::||.:::.|.:.      :.:|:...|:....:......||.
  Fly    67 RAILIYLAEKYDKDGSLYPKDPQQRAVINQRLFFD------LSTLYQSYVYYYYPQLFEDVKKPA 125

  Fly   135 SVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWME 199
            ....| |.::....:...|...:.:...:|||:||....:.::..::.:|:..  ::|:|.:|.:
  Fly   126 DPDNL-KKIDDAFAMFNTLLKGQQYAALNKLTLADFALLATVSTFEISEYDFG--KYPEVVRWYD 187

  Fly   200 RVRDATNPYYDE 211
            ..:... |.::|
  Fly   188 NAKKVI-PGWEE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 46/198 (23%)
GST_N_Theta 5..80 CDD:239348 22/74 (30%)
GST_C_Theta 93..218 CDD:198292 21/119 (18%)
GstD9NP_001287303.1 GST_N_Delta_Epsilon 2..75 CDD:239343 21/72 (29%)
GstA 4..187 CDD:223698 46/191 (24%)
GST_C_Delta_Epsilon 89..207 CDD:198287 21/120 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460066
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.