DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and Clic1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001002807.1 Gene:Clic1 / 406864 RGDID:1303043 Length:241 Species:Rattus norvegicus


Alignment Length:192 Identity:43/192 - (22%)
Similarity:69/192 - (35%) Gaps:55/192 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QPSRALWI-----AMKLGKTPFEDCPVALRKQEQLT------DEYRSINRFQK------VPAIVD 61
            ||...|::     ..|:|..||......:...:.:|      |..|.....||      :|.::.
  Rat     5 QPQVELFVKAGSDGAKIGNCPFSQRLFMVLWLKGVTFNVTTVDTKRRTETVQKLCPGGQLPFLLY 69

  Fly    62 GKFQLGESVSIVRYLADKGVFSEQLYPKTL-----EERARVDEFLEWQHF----NVRLVCSLFFR 117
            |.....::..|..:|  :.|.....|||..     ...:.:|.|.::..:    |..|..:|   
  Rat    70 GTEVHTDTNKIEEFL--EAVLCPPRYPKLAALNPESNTSGLDIFAKFSAYIKNSNPALNDNL--- 129

  Fly   118 QVWLLPAKGLAPA----------PKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVAD 169
                  .|||..|          |.||.|.:...:.|   |:.:|     .||.|::||:||
  Rat   130 ------EKGLLKALKVLDNYLTSPLPEEVDETSAEDE---GISQR-----KFLDGNELTLAD 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 43/192 (22%)
GST_N_Theta 5..80 CDD:239348 16/82 (20%)
GST_C_Theta 93..218 CDD:198292 23/91 (25%)
Clic1NP_001002807.1 Required for insertion into the membrane. /evidence=ECO:0000250 2..90 17/86 (20%)
O-ClC 6..241 CDD:129941 42/191 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348086
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.