DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstO1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_648237.1 Gene:GstO1 / 38975 FlyBaseID:FBgn0035907 Length:254 Species:Drosophila melanogaster


Alignment Length:243 Identity:48/243 - (19%)
Similarity:91/243 - (37%) Gaps:90/243 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 KTPFEDCPVALRKQEQLTDEYRSINRFQKVPAI----VDGKFQLGESVSIVRYLADKGVFSE-QL 86
            |.|:....:.||.:.:.   :..::...||||:    ..|...|.||:.|..||.:|  :.| .|
  Fly    44 KIPYHAIYINLRDKPEW---FSLVSSSTKVPALELVKEQGNPVLIESLIICDYLDEK--YPEVPL 103

  Fly    87 YPKTL----EERARVDEF-------------------LEWQHF--------NVRLVCSLFFRQVW 120
            |||.|    :|:..::.|                   ::..|:        .::..|:.||    
  Fly   104 YPKDLLKKAQEKILIERFGQFINAFYYLLLHDNPEQLVDTDHYAGLVVYEEELKRRCTKFF---- 164

  Fly   121 LLPAKGLAPAPKPESVKKLIKDVESNLGLLERL---WLEK-DFLVGDKLTVADIFGSSEINQMKL 181
                .|.:|                  |:|:.:   |.|: |.|   |.|...            
  Fly   165 ----GGDSP------------------GMLDYMMWPWCERFDSL---KYTFEQ------------ 192

  Fly   182 CQYNVNEKQFPKVAKWME-RVRD-ATNPYYDEAHSFV-YKTSQQAVKA 226
             ::.::.::||.:.||.: .::| |...:|.:..:.. |..|:::.:|
  Fly   193 -KFELSPERFPTLIKWRDLMIQDRAVKCFYLDGQTHAKYMNSRRSGQA 239

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 43/218 (20%)
GST_N_Theta 5..80 CDD:239348 15/56 (27%)
GST_C_Theta 93..218 CDD:198292 23/158 (15%)
GstO1NP_648237.1 Thioredoxin_like 3..95 CDD:294274 14/53 (26%)
GstA 22..216 CDD:223698 43/218 (20%)
GST_C_Omega 109..234 CDD:198293 24/166 (14%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460039
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.