DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and se

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_648235.1 Gene:se / 38973 FlyBaseID:FBgn0086348 Length:243 Species:Drosophila melanogaster


Alignment Length:239 Identity:52/239 - (21%)
Similarity:84/239 - (35%) Gaps:89/239 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 SKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAI----VDG 62
            :|.|.|:..:::...:..|:               |.|..|           .||||:    ..|
  Fly    42 AKQIPYHSIYINLTDKPEWL---------------LEKNPQ-----------GKVPALEIVREPG 80

  Fly    63 KFQLGESVSIVRYLADKGVFSEQLYP----KTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLP 123
            ...|.||:.|..|| |:......|||    |.::::..::.|        |.|...||:      
  Fly    81 PPVLTESLLICEYL-DEQYPLRPLYPRDPLKKVQDKLLIERF--------RAVLGAFFK------ 130

  Fly   124 AKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKD------------FLVGDKLTVADIF---GS 173
                                .|:.|.||..|...|            |..|::..:.|..   ..
  Fly   131 --------------------ASDGGDLEPFWSGLDIYERELARRGTEFFGGEQTGILDYMIWPWC 175

  Fly   174 SEINQMKLCQ---YNVNEKQFPKVAKWMERV-RD-ATNPYYDEA 212
            ..:..:||.:   ||.::.:||::..|:||: || |...:|.||
  Fly   176 ERLELLKLQRGEDYNYDQSRFPQLTLWLERMKRDPAVMAFYMEA 219

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 47/226 (21%)
GST_N_Theta 5..80 CDD:239348 18/78 (23%)
GST_C_Theta 93..218 CDD:198292 29/140 (21%)
seNP_648235.1 GST_N_Omega 3..95 CDD:239353 18/79 (23%)
GstA 22..215 CDD:223698 49/233 (21%)
GST_C_Omega 109..229 CDD:198293 30/145 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460037
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.