DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstE12

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001246500.1 Gene:GstE12 / 37960 FlyBaseID:FBgn0027590 Length:223 Species:Drosophila melanogaster


Alignment Length:251 Identity:71/251 - (28%)
Similarity:109/251 - (43%) Gaps:59/251 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65
            |||. ..||..||.||||:.:..|......|..|:.|.|.|.||.|:..:|....:|.::||:..
  Fly     1 MSKP-ALYYATLSPPSRAVLLTAKAIGLDLELRPINLLKGEHLTPEFLKLNPQHTIPTLIDGEAT 64

  Fly    66 LGESVSIVRYLADK-GVFSEQLYPKTLEERARVDE--FLEWQHFNVRL-------------VCSL 114
            :.:|.:|..||.:| |...:|||||.|.:||.||.  .|:..|...||             .||:
  Fly    65 IIDSHAICAYLVEKYGQKEQQLYPKELVQRANVDARLHLDSGHLFARLRFLYEPILYYGSTDCSI 129

  Fly   115 ----FFRQVWLLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSE 175
                :.::.|             |.::..:||              :.:|.|..||:||....:.
  Fly   130 DKIAYIQKCW-------------EILEGFLKD--------------QPYLCGSDLTIADFCAVAT 167

  Fly   176 INQMKLCQYN----VNEKQFPKVAKWMERVRDATNPYYDEAHSFVYKTSQQAVKAK 227
            :..:     |    ::|.:|||:..|::|:  |..|||.|.:.......:...|||
  Fly   168 VTSV-----NDTAPIDEFKFPKMHAWLKRL--AELPYYQEVNGDGADELKSIFKAK 216

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 60/222 (27%)
GST_N_Theta 5..80 CDD:239348 26/75 (35%)
GST_C_Theta 93..218 CDD:198292 32/147 (22%)
GstE12NP_001246500.1 GST_N_Delta_Epsilon 4..77 CDD:239343 25/73 (34%)
GstA 6..201 CDD:223698 64/228 (28%)
GST_C_Delta_Epsilon 92..210 CDD:198287 32/151 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460108
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.