DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstE4

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_611326.1 Gene:GstE4 / 37109 FlyBaseID:FBgn0063496 Length:222 Species:Drosophila melanogaster


Alignment Length:238 Identity:67/238 - (28%)
Similarity:118/238 - (49%) Gaps:31/238 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQ 65
            |.|...|..| .|.|:||..:.:|....|||...|.|.::|..::::...|....||.:.|....
  Fly     1 MGKISLYGLD-ASPPTRACLLTLKALDLPFEFVFVNLFEKENFSEDFSKKNPQHTVPLLQDDDAC 64

  Fly    66 LGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCS----------LFFRQVW 120
            :.:|.:|:.||.:|...|::||||.|.:||:||:.:   ||...::..          |||.:..
  Fly    65 IWDSHAIMAYLVEKYAPSDELYPKDLLQRAKVDQLM---HFESGVIFESALRRLTRPVLFFGEPT 126

  Fly   121 LLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYN 185
            |       |..:.:.:.::...||:.|.       :.||:.||:||:||....|.|..:.:. ..
  Fly   127 L-------PRNQVDHILQVYDFVETFLD-------DHDFVAGDQLTIADFSIVSTITSIGVF-LE 176

  Fly   186 VNEKQFPKVAKWMERVRDATNPYYDEAHSFVYKTSQQAVKAKN 228
            ::..::||:|.|:||:::.  |||:||:........:.:::||
  Fly   177 LDPAKYPKIAAWLERLKEL--PYYEEANGKGAAQFVELLRSKN 217

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 58/208 (28%)
GST_N_Theta 5..80 CDD:239348 21/74 (28%)
GST_C_Theta 93..218 CDD:198292 35/134 (26%)
GstE4NP_611326.1 GST_N_Delta_Epsilon 4..77 CDD:239343 21/73 (29%)
GstA 6..196 CDD:223698 58/210 (28%)
GST_C_Delta_Epsilon 91..209 CDD:198287 35/137 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460099
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.