DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstE10

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001286570.1 Gene:GstE10 / 37105 FlyBaseID:FBgn0063499 Length:240 Species:Drosophila melanogaster


Alignment Length:199 Identity:51/199 - (25%)
Similarity:100/199 - (50%) Gaps:9/199 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 SQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLA 77
            |.|.||:.:.::..:...|...:.::..:.|..:....|....||.:.||:..:.:|.:|:.||.
  Fly    12 SPPVRAVLLTLRALQLDHEFHTLDMQAGDHLKPDMLRKNPQHTVPMLEDGESCIWDSHAIIGYLV 76

  Fly    78 DKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKD 142
            :|...|::||||...:||.||:.|   ||...::....|:|:    .:.|......|..|..:.:
  Fly    77 NKYAQSDELYPKDPLKRAVVDQRL---HFETGVLFHGIFKQL----QRALFKENATEVPKDRLAE 134

  Fly   143 VESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAKWMERVRDATNP 207
            ::....|||:...|..::.|.:||:||....:.::.:.|....|:..::||::.|:.|:  :..|
  Fly   135 LKDAYALLEQFLAENPYVAGPQLTIADFSIVATVSTLHLSYCPVDATKYPKLSAWLARI--SALP 197

  Fly   208 YYDE 211
            :|:|
  Fly   198 FYEE 201

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 48/190 (25%)
GST_N_Theta 5..80 CDD:239348 15/66 (23%)
GST_C_Theta 93..218 CDD:198292 30/119 (25%)
GstE10NP_001286570.1 GstA 4..197 CDD:223698 48/193 (25%)
GST_N_Delta_Epsilon 4..77 CDD:239343 15/64 (23%)
GST_C_Delta_Epsilon 91..211 CDD:198287 30/120 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460097
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
76.650

Return to query results.
Submit another query.