DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and clic4

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_958894.1 Gene:clic4 / 368255 ZFINID:ZDB-GENE-030326-3 Length:252 Species:Danio rerio


Alignment Length:195 Identity:37/195 - (18%)
Similarity:73/195 - (37%) Gaps:72/195 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIV-DGKF 64
            ::|..:|..|.|..|..:     |||          .|..|..|   ..::.|.|..|.: :.|.
Zfish    87 VNKIEEYLEDILCPPKYS-----KLG----------ARHPESNT---AGMDIFAKFSAFIKNSKP 133

  Fly    65 QLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP 129
            ...|::       ::|:.      |||:   ::||:|          ||                
Zfish   134 DANEAL-------ERGLL------KTLQ---KLDEYL----------CS---------------- 156

  Fly   130 APKPESV-KKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPK 193
             |.|:.: ...:::|:::..:         ||.|:::|:||.....:::.:|:........:.||
Zfish   157 -PLPDEIDHNSMEEVKASTRM---------FLDGEEMTLADCNLLPKLHIVKVVAKKYRGFEIPK 211

  Fly   194  193
            Zfish   212  211

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 36/191 (19%)
GST_N_Theta 5..80 CDD:239348 15/75 (20%)
GST_C_Theta 93..218 CDD:198292 17/102 (17%)
clic4NP_958894.1 GST_N_CLIC 13..103 CDD:239359 5/15 (33%)
O-ClC 16..250 CDD:129941 37/195 (19%)
GST_C_CLIC4 110..250 CDD:198329 28/157 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589427
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.