Sequence 1: | NP_610509.2 | Gene: | GstT1 / 35995 | FlyBaseID: | FBgn0050000 | Length: | 228 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_958894.1 | Gene: | clic4 / 368255 | ZFINID: | ZDB-GENE-030326-3 | Length: | 252 | Species: | Danio rerio |
Alignment Length: | 195 | Identity: | 37/195 - (18%) |
---|---|---|---|
Similarity: | 73/195 - (37%) | Gaps: | 72/195 - (36%) |
- Green bases have known domain annotations that are detailed below.
Fly 1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIV-DGKF 64
Fly 65 QLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP 129
Fly 130 APKPESV-KKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPK 193
Fly 194 193 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
GstT1 | NP_610509.2 | GstA | 5..204 | CDD:223698 | 36/191 (19%) |
GST_N_Theta | 5..80 | CDD:239348 | 15/75 (20%) | ||
GST_C_Theta | 93..218 | CDD:198292 | 17/102 (17%) | ||
clic4 | NP_958894.1 | GST_N_CLIC | 13..103 | CDD:239359 | 5/15 (33%) |
O-ClC | 16..250 | CDD:129941 | 37/195 (19%) | ||
GST_C_CLIC4 | 110..250 | CDD:198329 | 28/157 (18%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C170589427 | |
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.930 |