DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstE14

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_610855.1 Gene:GstE14 / 36467 FlyBaseID:FBgn0033817 Length:232 Species:Drosophila melanogaster


Alignment Length:242 Identity:63/242 - (26%)
Similarity:104/242 - (42%) Gaps:42/242 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 YYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSI 72
            |||..|.|.|:..:.:||.....|...|.|.|.||...::.::|....||.:|.|...|.:|.:|
  Fly     9 YYDERSPPVRSCLMLIKLLDIDVELRFVNLFKGEQFQKDFLALNPQHSVPTLVHGDLVLTDSHAI 73

  Fly    73 VRYLADKGVFSE--QLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQ----VWLLPAKGLAPAP 131
            :.:||:|  |.|  .|:|:...||.:|...|.::       ||..||:    :.....:|.|...
  Fly    74 LIHLAEK--FDEGGSLWPQEHAERMKVLNLLLFE-------CSFLFRRDSDFMSATVRQGFANVD 129

  Fly   132 KPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYNVNEKQFPKVAK 196
            .....:||   .|:.: ::||.....||:.|.:||:||:   |.:..:..........|||::.:
  Fly   130 VAHHERKL---TEAYI-IMERYLENSDFMAGPQLTLADL---SIVTTLSTVNLMFPLSQFPRLRR 187

  Fly   197 W----------------MERVRDATNPYYDEAHSFVYKTSQQAVKAK 227
            |                :|::|..    .:...||.:.:|...|..|
  Fly   188 WFTAMQQLDAYEANCSGLEKLRQT----MESVGSFQFPSSSAVVTEK 230

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 58/217 (27%)
GST_N_Theta 5..80 CDD:239348 24/71 (34%)
GST_C_Theta 93..218 CDD:198292 31/144 (22%)
GstE14NP_610855.1 GstA 6..200 CDD:223698 56/206 (27%)
GST_N_Delta_Epsilon 6..79 CDD:239343 23/69 (33%)
GST_C_Delta_Epsilon 94..209 CDD:198287 28/128 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
54.820

Return to query results.
Submit another query.