DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTZ1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001350632.1 Gene:GSTZ1 / 2954 HGNCID:4643 Length:217 Species:Homo sapiens


Alignment Length:221 Identity:53/221 - (23%)
Similarity:99/221 - (44%) Gaps:57/221 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQ--EQLTDEYRSINRFQKVPAI-VDGKF 64
            |.|.|.| |.|..|..:.||:.|....:|..|:.|.|.  :|.:.:::::|..::||.: :|| .
Human     6 KPILYSY-FRSSCSWRVRIALALKGIDYETVPINLIKDGGQQFSKDFQALNPMKQVPTLKIDG-I 68

  Fly    65 QLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAP 129
            .:.:|::|:.||.:... :.:|.|:..::||           :||::..|.        |.|:.|
Human    69 TIHQSLAIIEYLEEMRP-TPRLLPQDPKKRA-----------SVRMISDLI--------AGGIQP 113

  Fly   130 APKPESVKKLIKDVE---------SNLGLLERLWLEKD---FLVGDKLTVADIFGSSEINQMKLC 182
            ......:|::.::::         .....||:: |:..   :.|||::|:||           ||
Human   114 LQNLSVLKQVGEEMQLTWAQNAITCGFNALEQI-LQSTAGIYCVGDEVTMAD-----------LC 166

  Fly   183 QYNVNEKQFPKVAKWMERVRDATNPY 208
                   ..|:||. .||.:....||
Human   167 -------LVPQVAN-AERFKVDLTPY 184

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 50/213 (23%)
GST_N_Theta 5..80 CDD:239348 23/77 (30%)
GST_C_Theta 93..218 CDD:198292 27/128 (21%)
GSTZ1NP_001350632.1 maiA 8..212 CDD:273527 52/219 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.