DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and Clic2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001009651.1 Gene:Clic2 / 294141 RGDID:1306580 Length:245 Species:Rattus norvegicus


Alignment Length:227 Identity:48/227 - (21%)
Similarity:81/227 - (35%) Gaps:69/227 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 LWI-AMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGKFQLGESVSIVRYLADKGVF 82
            ||: .:|...|..:    ..||.|:|.|.....|     |..:                      
  Rat    40 LWLKGVKFNVTTID----TARKPEELKDLAPGTN-----PPFL---------------------- 73

  Fly    83 SEQLYPKTLE-ERARVDEFLE-------WQHFNVR------LVCSLFFRQVWLLPAKGLAPAPKP 133
               :|.|.|: :..:::||||       :.|.:.:      :.|:||.:  :....|........
  Rat    74 ---IYNKELKTDFIKIEEFLEKTLAPPRYPHLSPKYKESFDVGCNLFAK--FSAYIKNTQKEANK 133

  Fly   134 ESVKKLIKDVES-----NLGLL---------ERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQY 184
            ...|.|:::.:.     |..||         ||....:.||.||:||:||.....::|.:|:...
  Rat   134 NFEKSLLREFKRLDDYLNTPLLDEIDPDSTEERTLSRRLFLDGDQLTLADCSLLPKLNIIKVAAK 198

  Fly   185 NVNEKQFPKVAKWMERVRDATNPYYDE--AHS 214
            ...:...|  |::....|...|.|..|  ||:
  Rat   199 KYRDFDIP--AEFSGVWRYLHNAYAREEFAHT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 43/213 (20%)
GST_N_Theta 5..80 CDD:239348 11/61 (18%)
GST_C_Theta 93..218 CDD:198292 34/151 (23%)
Clic2NP_001009651.1 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 18/89 (20%)
GST_N_CLIC 9..99 CDD:239359 18/92 (20%)
O-ClC 12..245 CDD:129941 48/227 (21%)
GST_C_CLIC2 106..244 CDD:198331 29/127 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166348041
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.