DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gst2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_588517.1 Gene:gst2 / 2539601 PomBaseID:SPCC965.07c Length:230 Species:Schizosaccharomyces pombe


Alignment Length:240 Identity:61/240 - (25%)
Similarity:103/240 - (42%) Gaps:65/240 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 IAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIVDGK---FQLGESVSIVRYLADKGVF 82
            :|:|.....:|......:|.||...|:.::|...:||.:||.|   :.:.||.:|:.|||||   
pombe    20 LALKELNLSYEQIFYDFQKGEQKCKEHLALNPNGRVPTLVDHKNNDYTIWESDAILIYLADK--- 81

  Fly    83 SEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQ-----VWLLPAKGLA-------PAPKPES 135
                |.   .:|.....|.:.:::  :|:..|||:.     :|     |.|       ..|...:
pombe    82 ----YD---TDRKISLSFDDPEYY--KLIQYLFFQASGQGVIW-----GQAGWFNFFHHEPVVSA 132

  Fly   136 VKKLIKDVESNLGLLERLWLEKDFLVGDKLTVAD------------IFG------SSEINQMKLC 182
            |.:...:::..||:||.:..::|:||.:|.|:||            :||      ..|:.|:.. 
pombe   133 VTRYRNEIKRVLGVLEDILKDRDYLVANKYTIADLSFIPWNYNLGGLFGEGKFSFKEEVPQLDF- 196

  Fly   183 QYNVNEKQFPKVAKWMERVRDATNPYYDEAHSFVYKTSQQAVKAK 227
                 ||:|||...|.:|:.         |...|..|.::..|||
pombe   197 -----EKEFPKAYAWNQRLL---------ARPAVKATFEELAKAK 227

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 55/215 (26%)
GST_N_Theta 5..80 CDD:239348 20/61 (33%)
GST_C_Theta 93..218 CDD:198292 35/154 (23%)
gst2NP_588517.1 GST_N_Ure2p_like 4..84 CDD:239346 22/73 (30%)
GstA 5..226 CDD:223698 58/237 (24%)
GST_C_Ure2p 96..219 CDD:198326 33/144 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100130
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
TreeFam 00.000 Not matched by this tool.
54.710

Return to query results.
Submit another query.