DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GstE9

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_725784.1 Gene:GstE9 / 246581 FlyBaseID:FBgn0063491 Length:221 Species:Drosophila melanogaster


Alignment Length:219 Identity:57/219 - (26%)
Similarity:100/219 - (45%) Gaps:31/219 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIV-DGKF 64
            |.|.:.|..: .|.|.||..:.:......:|...|.|...|..|.|:...|....||.:. ||||
  Fly     1 MGKLVLYGVE-ASPPVRACKLTLDALGLQYEYRLVNLLAGEHKTKEFSLKNPQHTVPVLEDDGKF 64

  Fly    65 QLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFN--------VR-LVCSLFFRQVW 120
             :.||.:|..||..:...|:.||||...:||.||:.|   ||.        :| :...||::.:.
  Fly    65 -IWESHAICAYLVRRYAKSDDLYPKDYFKRALVDQRL---HFESGVLFQGCIRNIAIPLFYKNIT 125

  Fly   121 LLPAKGLAPAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIFGSSEINQMKLCQYN 185
            .:|...:      :::.:....:|:.:|       .:.:|.|..:|:||....|.::.: :....
  Fly   126 EVPRSQI------DAIYEAYDFLEAFIG-------NQAYLCGPVITIADYSVVSSVSSL-VGLAA 176

  Fly   186 VNEKQFPKVAKWMERVRDATNPYY 209
            ::.|::||:..|::|:  |..|.|
  Fly   177 IDAKRYPKLNGWLDRM--AAQPNY 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 52/208 (25%)
GST_N_Theta 5..80 CDD:239348 23/75 (31%)
GST_C_Theta 93..218 CDD:198292 27/126 (21%)
GstE9NP_725784.1 GstA 4..201 CDD:223698 55/216 (25%)
GST_N_Delta_Epsilon 4..76 CDD:239343 22/73 (30%)
GST_C_Delta_Epsilon 92..209 CDD:198287 27/126 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45460101
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 1 1.000 - - FOG0000035
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
65.750

Return to query results.
Submit another query.