DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and Gdap1l1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_659140.2 Gene:Gdap1l1 / 228858 MGIID:2385163 Length:367 Species:Mus musculus


Alignment Length:113 Identity:26/113 - (23%)
Similarity:50/113 - (44%) Gaps:23/113 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   136 VKKLIKDVESNL----GLLERLWLEKD------FLVGDKLTVADIFGSSEINQMKLCQYNVNEKQ 190
            :||::.::...|    ..||:..||.:      :|.|...|:||:...:.::::|.  ..:::|.
Mouse   227 LKKILGELAMVLDQIEAELEKRKLENEGQTCELWLCGCAFTLADVLLGATLHRLKF--LGLSKKY 289

  Fly   191 F-----PKVAKWMERV--RDATNPYYDEAH----SFVYKTSQQAVKAK 227
            :     |.:..:.|||  |.|......:.|    |.|...:.:.||.|
Mouse   290 WEDGSRPNLQSFFERVQRRFAFRKVLGDIHTTLLSAVIPNAFRLVKRK 337

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 19/84 (23%)
GST_N_Theta 5..80 CDD:239348
GST_C_Theta 93..218 CDD:198292 23/102 (23%)
Gdap1l1NP_659140.2 GstA 47..314 CDD:223698 20/88 (23%)
GST_N_GDAP1 47..119 CDD:239350
GST_C_family 201..311 CDD:295467 19/85 (22%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167844617
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.