DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment GstT1 and Clic5

DIOPT Version :9

Sequence 1:	NP_610509.2	Gene:	GstT1 / 35995	FlyBaseID:	FBgn0050000	Length:	228	Species:	Drosophila melanogaster
Sequence 2:	XP_006524198.1	Gene:	Clic5 / 224796	MGIID:	1917912	Length:	485	Species:	Mus musculus

Alignment Length:	40	Identity:	13/40 - (32%)
Similarity:	23/40 - (57%)	Gaps:	8/40 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   130 APKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVAD 169
            :|.||       ::::|....|: ..::.||.||:||:||
Mouse   388 SPLPE-------EIDTNTHGDEK-GSQRKFLDGDELTLAD 419

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
GstT1	NP_610509.2	GstA	5..204	CDD:223698	13/40 (33%)
		GST_N_Theta	5..80	CDD:239348
		GST_C_Theta	93..218	CDD:198292	13/40 (33%)
Clic5	XP_006524198.1	O-ClC	248..483	CDD:129941	13/40 (33%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C167844623
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930