DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gst-42

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_509962.1 Gene:gst-42 / 183911 WormBaseID:WBGene00001790 Length:214 Species:Caenorhabditis elegans


Alignment Length:233 Identity:58/233 - (24%)
Similarity:95/233 - (40%) Gaps:56/233 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPA-IVDGKFQL 66
            |.:.|.| :.|..|..:.||:.|....:|...|.| ..|:...:.:.||...|||. :|||:. :
 Worm     5 KPVLYSY-WRSSCSWRVRIALALKNVDYEYKTVDL-LSEEAKSKLKEINPAAKVPTFVVDGQV-I 66

  Fly    67 GESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAP 131
            .||::|:.||.:... ...|.||...:||..                   |.:.||.|.|:.|..
 Worm    67 TESLAIIEYLEETHP-DVPLLPKDPIKRAHA-------------------RAISLLVASGIQPLH 111

  Fly   132 KPESVKKLIKDVESNLG-------------LLERLWLEKD--FLVGDKLTVAD------IFGSSE 175
            ..: |.:|:...|:..|             .||.|..:..  :.|||.:|:||      |:.:: 
 Worm   112 NLK-VLQLLNKKEAGFGGQFAKQFVVEGLTALEILLKQHSGKYAVGDDVTIADLSIPPLIYSAN- 174

  Fly   176 INQMKLCQYNVNEKQFPKVAKWMERVRDATNPYYDEAH 213
                   ::|::...:|.|.:..|.:.|.  |.:..||
 Worm   175 -------RFNLDLSPYPTVNRINETLADI--PAFIAAH 203

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 53/220 (24%)
GST_N_Theta 5..80 CDD:239348 24/75 (32%)
GST_C_Theta 93..218 CDD:198292 30/142 (21%)
gst-42NP_509962.1 GST_N_Zeta 6..77 CDD:239340 23/73 (32%)
maiA 7..211 CDD:273527 57/231 (25%)
GST_C_Zeta 90..207 CDD:198300 30/144 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG0625
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.