DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gst-27

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_497116.1 Gene:gst-27 / 175166 WormBaseID:WBGene00001775 Length:209 Species:Caenorhabditis elegans


Alignment Length:217 Identity:61/217 - (28%)
Similarity:100/217 - (46%) Gaps:47/217 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 QPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAI-VDGKFQLGESVSIVRYLA 77
            :|:|.|:   .|...||||..:.:  .:...:..::...|.:.|.: ||| |::.:|.:|.||||
 Worm    16 EPARILF---HLADVPFEDFRMTI--GDGTWENLKAKTPFGQAPVLSVDG-FEIPQSAAINRYLA 74

  Fly    78 DKGVFSEQLYPKTLEERARVDEFL-EWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIK 141
            .:..::    .||.||:|..|..: :::.|.|.:      ::|    .|..|.....|.|.|:|:
 Worm    75 KQFGYA----GKTPEEQAWTDAIVDQYKDFMVSI------KEV----GKASAAGKSAEEVGKIIQ 125

  Fly   142 -DV----ESNLGLLERLWLEKD---FLVGDKLTVADI--------------FGSSEINQMKLCQY 184
             |:    ::...::.:: |||.   |||||.||:|||              |.:||  |.||...
 Worm   126 SDLVPARDAFFVIINKI-LEKSKSGFLVGDGLTIADIVIVECITTLDKHQLFTASE--QPKLVAL 187

  Fly   185 NVNEKQFPKVAKWMERVRDATN 206
            .......|.:.||:|...|..|
 Worm   188 REKVYAIPAIKKWVEIRPDTLN 209

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 59/213 (28%)
GST_N_Theta 5..80 CDD:239348 20/66 (30%)
GST_C_Theta 93..218 CDD:198292 38/137 (28%)
gst-27NP_497116.1 GST_N_Sigma_like 4..75 CDD:239337 19/64 (30%)
PTZ00057 6..208 CDD:173353 60/214 (28%)
GST_C_Sigma_like 85..191 CDD:198301 33/118 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1231780at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X30
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.920

Return to query results.
Submit another query.