DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and GSTO2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_899062.1 Gene:GSTO2 / 119391 HGNCID:23064 Length:243 Species:Homo sapiens


Alignment Length:88 Identity:25/88 - (28%)
Similarity:34/88 - (38%) Gaps:19/88 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 CPVALR-----KQEQLTDEYRSIN------------RFQKVPAIVDGKFQL-GESVSIVRYLADK 79
            ||.:.|     |.:.:..|..:||            .|..:|.:...:.|| .|||....|| |.
Human    32 CPYSHRTRLVLKAKDIRHEVVNINLRNKPEWYYTKHPFGHIPVLETSQCQLIYESVIACEYL-DD 95

  Fly    80 GVFSEQLYPKTLEERARVDEFLE 102
            .....:|:|....||||....||
Human    96 AYPGRKLFPYDPYERARQKMLLE 118

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 25/88 (28%)
GST_N_Theta 5..80 CDD:239348 17/64 (27%)
GST_C_Theta 93..218 CDD:198292 6/10 (60%)
GSTO2NP_899062.1 Thioredoxin_like 7..94 CDD:320948 16/62 (26%)