DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and CLIC2

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001280.3 Gene:CLIC2 / 1193 HGNCID:2063 Length:247 Species:Homo sapiens


Alignment Length:137 Identity:30/137 - (21%)
Similarity:56/137 - (40%) Gaps:34/137 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 LYPKTLE-ERARVDEFLE-------WQHFNVR------LVCSLFFRQVWLLPAKGLAPAPKPESV 136
            :|.|.|: :..:::||||       :.|.:.:      :.|:||.:  :....|...........
Human    74 VYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAK--FSAYIKNTQKEANKNFE 136

  Fly   137 KKLIKDVES-----NLGLLERLWLEKD-----------FLVGDKLTVADIFGSSEINQMKLCQYN 185
            |.|:|:.:.     |..||:.  ::.|           ||.||:||:||.....::|.:|:....
Human   137 KSLLKEFKRLDDYLNTPLLDE--IDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNIIKVAAKK 199

  Fly   186 VNEKQFP 192
            ..:...|
Human   200 YRDFDIP 206

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 30/137 (22%)
GST_N_Theta 5..80 CDD:239348
GST_C_Theta 93..218 CDD:198292 27/129 (21%)
CLIC2NP_001280.3 Required for insertion into the membrane. /evidence=ECO:0000250 1..96 7/21 (33%)
N-terminal 1..94 7/19 (37%)
O-ClC 12..245 CDD:129941 30/137 (22%)
Joint loop 95..106 1/10 (10%)
C-terminal 107..247 22/104 (21%)
Foot loop 151..171 4/21 (19%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165154390
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.