DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and vars1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:NP_001298275.1 Gene:vars1 / 114427 ZFINID:ZDB-GENE-010601-1 Length:1271 Species:Danio rerio


Alignment Length:214 Identity:45/214 - (21%)
Similarity:75/214 - (35%) Gaps:75/214 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 FLSQPSRALWIAMKLGKTPFEDCPVALRKQEQLTDEYRSINRFQKVPAIV---DGKFQLGESVSI 72
            |...|.|.|          .:|.|..|.:..               ||:|   .|...|..:.::
Zfish    24 FCPSPPRIL----------HQDPPAELARSR---------------PALVLAGAGGTVLSGTSAV 63

  Fly    73 VRYLADKGVFSEQLYPKTLEERARVDEFLE---WQHFN------VRLVCSLFFRQVWLLPA-KGL 127
            ..|||..|            :||..|:..|   ||..:      ..:.|::.|..:.::.. |.|
Zfish    64 SWYLAATG------------KRAGSDKKQESQVWQWLSFAENELTPVACAVAFPLLGIMGVDKKL 116

  Fly   128 APAPKPESVKKLIKDVESNLGLLERLWLEKDFLVGDKLTVADIF-----------------GSSE 175
            ..:.:.| :.:::|.::..|.|       :.||||:.:|:||..                 ..|.
Zfish   117 QQSSRAE-LLRVLKALDGTLAL-------RTFLVGESVTLADAAVAMAALLPFKYALEPADRKSL 173

  Fly   176 INQMKLCQYNVNEKQFPKV 194
            :|..:.....||:.||.||
Zfish   174 VNVTRWFNTCVNQPQFLKV 192

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 45/214 (21%)
GST_N_Theta 5..80 CDD:239348 15/71 (21%)
GST_C_Theta 93..218 CDD:198292 29/129 (22%)
vars1NP_001298275.1 GstA <45..192 CDD:223698 36/166 (22%)
GST_C_ValRS_N 80..202 CDD:198327 26/121 (21%)
PTZ00419 291..1270 CDD:240411
ValRS_core 340..941 CDD:185677
tRNA-synt_1_2 518..643 CDD:290334
Anticodon_Ia_Val 941..1081 CDD:153416
Val_tRNA-synt_C 1203..1266 CDD:287436
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.