DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and LOC100333907

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_009303556.1 Gene:LOC100333907 / 100333907 -ID:- Length:249 Species:Danio rerio


Alignment Length:93 Identity:22/93 - (23%)
Similarity:32/93 - (34%) Gaps:47/93 - (50%)


- Green bases have known domain annotations that are detailed below.


  Fly    83 SEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGLAPAPKPESVKKLIKDVESNL 147
            :|.|....|:...|:||:|:                           .|.||.:     |.:|  
Zfish   134 NEGLEKALLKSLKRLDEYLQ---------------------------TPLPEEI-----DADS-- 164

  Fly   148 GLLERLWLE------KDFLVGDKLTVAD 169
                   ||      :.||.||:||:||
Zfish   165 -------LEDPGASTRSFLDGDELTLAD 185

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 22/93 (24%)
GST_N_Theta 5..80 CDD:239348
GST_C_Theta 93..218 CDD:198292 19/83 (23%)
LOC100333907XP_009303556.1 O-ClC 14..249 CDD:129941 22/93 (24%)
GST_N_CLIC 14..101 CDD:239359
GST_C_family 108..248 CDD:295467 22/93 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170589508
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.