DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment GstT1 and gstz1

DIOPT Version :9

Sequence 1:NP_610509.2 Gene:GstT1 / 35995 FlyBaseID:FBgn0050000 Length:228 Species:Drosophila melanogaster
Sequence 2:XP_002938913.1 Gene:gstz1 / 100145591 XenbaseID:XB-GENE-978910 Length:216 Species:Xenopus tropicalis


Alignment Length:197 Identity:49/197 - (24%)
Similarity:86/197 - (43%) Gaps:63/197 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSKAIKYYYDFLSQPSRALWIAMKLGKTPFEDCPVALRKQ--EQLTDEYRSINRFQKVPAI-VDG 62
            :.|.:.|.| |.|..|..:.||:......::...:.|.|.  .||::||:.:|..|:|||: :||
 Frog     4 LGKPLLYGY-FRSSCSWRVRIALAFKGIEYDQQVINLVKDGGMQLSNEYKQVNPMQQVPALCIDG 67

  Fly    63 KFQLGESVSIVRYLADKGVFSEQLYPKTLEERARVDEFLEWQHFNVRLVCSLFFRQVWLLPAKGL 127
             ..|.:|::|:.||.:... :..|.|:..::||:           ||::..    |:    |.|:
 Frog    68 -VTLSQSLAIIEYLEETRP-NPPLLPRDPKKRAQ-----------VRMISD----QI----ASGI 111

  Fly   128 APAPKPESVKKLIKDVESNLGLLERL------W-----------LEK-------DFLVGDKLTVA 168
            .|.              .||.:|:::      |           |||       .:.|||::|:|
 Frog   112 QPL--------------QNLCVLQKIGETKLEWAKHFITRGFQALEKLLQTTAGRYCVGDEVTIA 162

  Fly   169 DI 170
            |:
 Frog   163 DL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
GstT1NP_610509.2 GstA 5..204 CDD:223698 48/193 (25%)
GST_N_Theta 5..80 CDD:239348 25/77 (32%)
GST_C_Theta 93..218 CDD:198292 21/102 (21%)
gstz1XP_002938913.1 maiA 8..211 CDD:273527 48/193 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.