DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and PDR16

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_014168.1 Gene:PDR16 / 855490 SGDID:S000005175 Length:351 Species:Saccharomyces cerevisiae


Alignment Length:284 Identity:46/284 - (16%)
Similarity:89/284 - (31%) Gaps:99/284 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 EALRTWIDKQIYLEARTDDQFLVAFLRFCRWDVEEAKKRVLFYYTYKSKERELLKGRQVDDKLI- 94
            |..:.|:.::.:|.          :||..:|.:::...|:.....::.:......|.:..||:. 
Yeast    79 EEEKAWLTRECFLR----------YLRATKWVLKDCIDRITMTLAWRREFGISHLGEEHGDKITA 133

  Fly    95 -------ELARSGI--FATLPKPIGPGGPRIHYTRMGHIEPSKHSVSDIFRFHAFRAEIEINTDD 150
                   |..:..|  :....:||....|....|:..| ...:|.|..:.|.      |:.....
Yeast   134 DLVAVENESGKQVILGYENDARPILYLKPGRQNTKTSH-RQVQHLVFMLERV------IDFMPAG 191

  Fly   151 NWNIAGVVEIIDFTKIPYSLLLQFDPGMFKRMNAFLEHGIPANLVATHIVNASRETQFVLGLVRN 215
            ..::|.:::..|:..:|                     .:|.|         |:.....:|    
Yeast   192 QDSLALLIDFKDYPDVP---------------------KVPGN---------SKIPPIGVG---- 222

  Fly   216 VMKQKELLHIHSTVASLRKAIGLEYLPVEMGGDNGSLS-----------------DAMTR----Y 259
                ||:|||..|           :.|..:|  ...|:                 |.:||    :
Yeast   223 ----KEVLHILQT-----------HYPERLG--KALLTNIPWLAWTFLKLIHPFIDPLTREKLVF 270

  Fly   260 ETQLLSFSPYFTEDERYGVDEKLR 283
            :...:.:.|....|..||.|.|.:
Yeast   271 DEPFVKYVPKNELDSLYGGDLKFK 294

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 6/37 (16%)
CRAL_TRIO 100..248 CDD:279044 25/149 (17%)
PDR16NP_014168.1 CRAL_TRIO_N 47..109 CDD:397711 7/39 (18%)
CRAL_TRIO 142..290 CDD:395525 33/205 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343337
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.