DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG1902 and SFH5

DIOPT Version :9

Sequence 1:NP_610507.1 Gene:CG1902 / 35993 FlyBaseID:FBgn0033434 Length:312 Species:Drosophila melanogaster
Sequence 2:NP_012390.1 Gene:SFH5 / 853296 SGDID:S000003681 Length:294 Species:Saccharomyces cerevisiae


Alignment Length:291 Identity:55/291 - (18%)
Similarity:95/291 - (32%) Gaps:115/291 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    64 EEAKKRVLFYYTYKSKER---ELLKGRQVD-----DKLIELARSGIFATLPKPIGPGGPRIHYTR 120
            ||..|    ||..|..:|   :|.|..|.:     ..||::..   :.....|:......:|.|.
Yeast    46 EEVDK----YYDEKIADRLTYKLCKAYQFEYSTIVQNLIDILN---WRREFNPLSCAYKEVHNTE 103

  Fly   121 MGHIEPSKHSVSDIFRFHAFRAEIEINTDDN-----WNIAGV----------------------- 157
            :.::        .|..|.|       |.|.|     ||:.|.                       
Yeast   104 LQNV--------GILTFDA-------NGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGLME 153

  Fly   158 --VEIIDFTKIPYSLLLQFDPGMFK-----RMNAFLEH------GI-----PANLVATHIVNASR 204
              :.::|||....:.:.|...  :|     ||::.:::      ||     |..|.|.:.||...
Yeast   154 KGLSLLDFTSSDNNYMTQVHD--YKGVSVWRMDSDIKNCSKTVIGIFQKYYPELLYAKYFVNVPT 216

  Fly   205 ETQFVLGLVRNVMKQKELLHIHSTVASLRKAIGLEYLPVEMGGDNGSLSDAMTRYETQLLSFSPY 269
            ...:|..|::..:.:           :.||    :::.:..|...|           |.|...||
Yeast   217 VFGWVYDLIKKFVDE-----------TTRK----KFVVLTDGSKLG-----------QYLKDCPY 255

  Fly   270 FTEDERYGVDEKLREASEKDQERGAPLVTDV 300
                |.||..:|....::::       ||:|
Yeast   256 ----EGYGGKDKKNNLTKQN-------VTNV 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG1902NP_610507.1 CRAL_TRIO_N 28..69 CDD:215024 2/4 (50%)
CRAL_TRIO 100..248 CDD:279044 31/193 (16%)
SFH5NP_012390.1 SEC14 101..263 CDD:214706 37/208 (18%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1471
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.